HPA000551

KIAA1210 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000551
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000551, RRID:AB_1079165
Product name
Anti-KIAA1210 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000551
Antibody type
Polyclonal
Antigen
Uncharacterized protein KIAA1210 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SQPETTTPQGLLSDKDDMGRRNAGIDFGSRKASAA
QPIPENMDNSMVSDPQPYHEDAASGAEKTEARASL
SLMVESLSTTQEEAILSVAAEAQVFMNPSHIQLED
QEAFSFDLQKAQSKMESAQDVQTICKEKPSGNVHQ
TFTASV
Storage
-20C
Provider Type Product Number
- No reagents -