HPA018316

RWDD2B antibody from MilliporeSigma / Merck KGaA
C21orf6, GL011
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018316
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018316, RRID:AB_1845702
Product name
Anti-C21orf6 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018316
Antibody type
Polyclonal
Antigen
RWD domain-containing protein 2B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LIRHREDIPFDGTNDETERQRKFSIFEEKVFSVNG
ARGNHMDFGQLYQFLNTKGCGDVFQMFFGVEGQ
Storage
-20C
Provider Type Product Number
- No reagents -