HPA015800

DEPDC7 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015800
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015800, RRID:AB_1847610
Product name
Anti-DEPDC7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015800
Antibody type
Polyclonal
Antigen
DEP domain-containing protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TTIPNQDSQLGKENKLYSPARYADALFKSSDIRSA
SLEDLWENLSLKPANSPHVNISATLSPQVINEVWQ
EETIGRLLQLVDLPLLDSLLKQQEAVPKIPQPKRQ
STMVNSS
Storage
-20C
Provider Type Product Number
- No reagents -