HPA021140

USP16 antibody from Sigma-Aldrich
Ubp-M
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021140
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021140, RRID:AB_1858668
Product name
Anti-USP16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021140
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYV
RKQASITTPKPAEKDNGNIELENKKLEKESKNEQE
REKKENMAKENPPMNSPCQITVKGLSNLGNTCFFN
AVMQNLSQTPVLRELLKEVKM
Storage
-20C
Provider Type Product Number
- No reagents -