Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000978 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-RHOBTB3
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IIAAVGTRQNEELPCTCPLCTSDRGSCVSTTEGIQ
LAKELGATYLELHSLDDFYIGKYFGGVLEYFMIQA
LNQKTSEKMKKRKMSNSFHGIRPPQLEQPE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references From Gene Expression Analysis to Tissue Microarrays
Ek S, Andréasson U, Hober S, Kampf C, Pontén F, Uhlén M, Merz H, Borrebaeck C
Molecular & Cellular Proteomics 2006;5(6):1072-1081
Molecular & Cellular Proteomics 2006;5(6):1072-1081
No comments: Submit comment
No validations: Submit validation data