HPA000978

RHOBTB3 antibody from Sigma-Aldrich
KIAA0878
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000978
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000978, RRID:AB_1079811
Product name
Anti-RHOBTB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000978
Antibody type
Polyclonal
Antigen
Rho-related BTB domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IIAAVGTRQNEELPCTCPLCTSDRGSCVSTTEGIQ
LAKELGATYLELHSLDDFYIGKYFGGVLEYFMIQA
LNQKTSEKMKKRKMSNSFHGIRPPQLEQPE
Storage
-20C
Provider Type Product Number
- No reagents -