HPA023440

SHISA6 antibody from Sigma-Aldrich
FLJ45455
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023440
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023440, RRID:AB_1848945
Product name
Anti-AC007510.1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023440
Antibody type
Polyclonal
Antigen
UPF0626 protein B Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSTERLHSQDPLLSPERTAFPEQSLSRAISHTDVF
VSTPVLDRYRMSKMHSHPSASNNSYATLGQSQTAA
KRHAFASRRHNTVEQLHYIPGHHTCYTASKTEVTV
Storage
-20C
Provider Type Product Number
- No reagents -