Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501425 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Potassium Channel Regulator (KCNRG) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNRG antibody: synthetic peptide directed towards the middle region of human KCNRG
- Description
- Affinity Purified
- Reactivity
- Human, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
DTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEV
LITNE TPKPETIIIP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genetic and expression analysis of the KCNRG gene in hepatocellular carcinomas.
Cho YG, Kim CJ, Song JH, Rhie DJ, Park YK, Kim SY, Nam SW, Yoo NJ, Lee JY, Park WS
Experimental & molecular medicine 2006 Jun 30;38(3):247-55
Experimental & molecular medicine 2006 Jun 30;38(3):247-55
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting