HPA000367

TRIM13 antibody from Sigma-Aldrich
DLEU5, Leu5, RFP2, RNF77
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000367
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000367, RRID:AB_1856196
Product name
Anti-TRIM13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000367
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHT
LDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQ
EQRMAFNIAEAFKDVSEPIVFLQQMQEFREKIKVI
KETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKL
SLP
Storage
-20C
Provider Type Product Number
- No reagents -