Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000568 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-KDM6A
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST)
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWF
VVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYE
ANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNI
AWNV- Isotype
- IgG
- Vial size
- 100µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references The histone chaperone Spt6 coordinates histone H3K27 demethylation and myogenesis
Wang A, Zare H, Mousavi K, Wang C, Moravec C, Sirotkin H, Ge K, Gutierrez-Cruz G, Sartorelli V
The EMBO Journal 2013;32(8):1075-1086
The EMBO Journal 2013;32(8):1075-1086
No comments: Submit comment
No validations: Submit validation data