HPA000568

KDM6A antibody from Sigma-Aldrich
UTX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000568
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000568, RRID:AB_1858705
Product name
Anti-UTX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000568
Antibody type
Polyclonal
Antigen
Histone demethylase UTX (Ubiquitously transcribed X chromosome tetratricopeptide repeat protein) (Ubiquitously transcribed TPR protein on the X chromosome) (Lysine demethylase 6A)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWF
VVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYE
ANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNI
AWNV
Storage
-20C
Provider Type Product Number
- No reagents -