HPA051099
antibody from Atlas Antibodies
Targeting: DNAAF6
CXorf41, MGC35261, NYSAR97, PIH1D3, TWISTER
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA051099 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA051099, RRID:AB_2681342
- Product name
- Anti-PIH1D3
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LKVIPETSEENNEDIWNSEEIPEGAEYDDMWDVRE
IPEYEIIFRQQVGTEDIFLGLSKKDSSTGCCSELV
AKIKLPNT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references X-linked primary ciliary dyskinesia due to mutations in the cytoplasmic axonemal dynein assembly factor PIH1D3
Olcese C, Patel M, Shoemark A, Kiviluoto S, Legendre M, Williams H, Vaughan C, Hayward J, Goldenberg A, Emes R, Munye M, Dyer L, Cahill T, Bevillard J, Gehrig C, Guipponi M, Chantot S, Duquesnoy P, Thomas L, Jeanson L, Copin B, Tamalet A, Thauvin-Robinet C, Papon J, Garin A, Pin I, Vera G, Aurora P, Fassad M, Jenkins L, Boustred C, Cullup T, Dixon M, Onoufriadis A, Bush A, Chung E, Antonarakis S, Loebinger M, Wilson R, Armengot M, Escudier E, Hogg C, Al-Turki S, Anderson C, Antony D, Barroso I, Beales P, Bentham J, Bhattacharya S, Carss K, Chatterjee K, Cirak S, Cosgrove C, Allan D, Durbin R, Fitzpatrick D, Floyd J, Foley A, Franklin C, Futema M, Humphries S, Hurles M, McCarthy S, Muddyman D, Muntoni F, Parker V, Payne F, Plagnol V, Raymond L, Savage D, Scambler P, Schmidts M, Semple R, Serra E, Stalker J, van Kogelenberg M, Vijayarangakannan P, Walter K, Amselem S, Sun Z, Bartoloni L, Blouin J, Mitchison H
Nature Communications 2017;8(1)
Nature Communications 2017;8(1)
No comments: Submit comment
No validations: Submit validation data