Antibody data

Product number
ABIN183288
Provider
antibodies-online
Product name
anti-CAMP Responsive Element Binding Protein 3-Like 1 (CREB3L1) antibody
Provider product page
antibodies-online - ABIN183288
Antibody type
Polyclonal
Antigen
The immunogen for anti-CREB3L1 antibody: synthetic peptide directed towards the N terminal of human CREB3L1
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
FTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDS
PTPGI QAEHSYSLSG
Vial size
0.1 mg
Provider Type Product Number
- No reagents -