HPA024069

CREB3L1 antibody from Sigma-Aldrich
OASIS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024069
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024069, RRID:AB_1854750
Product name
Anti-CREB3L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024069
Antibody type
Polyclonal
Antigen
cAMP-responsive element-binding protein 3-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFF
DDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDS
APQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVK
QE
Storage
-20C
Provider Type Product Number
- No reagents -