HPA000658

TECPR2 antibody from Atlas Antibodies
KIAA0329
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000658
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000658, RRID:AB_1079191
Product name
Anti-TECPR2
Provider product page
Atlas Antibodies - HPA000658
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VSVHSSPNDQMLWVLDSRWNVHVRTGITEEMPVGT
AWEHVPGLQACQLALSTRTVWARCPNGDLARRYGV
TDKNPAGDYWKKIPGSVSCFTVTASDELWAVGPPG
YLLQRLTKTFSHSHGTQKSSQAAMPHPEDLEDEWE
VI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -