HPA000658

TECPR2 antibody from Sigma-Aldrich
KIAA0329
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000658
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000658, RRID:AB_1079191
Product name
Anti-TECPR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000658
Antibody type
Polyclonal
Antigen
WD repeat-containing protein KIAA0329/KIAA0297
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSVHSSPNDQMLWVLDSRWNVHVRTGITEEMPVGT
AWEHVPGLQACQLALSTRTVWARCPNGDLARRYGV
TDKNPAGDYWKKIPGSVSCFTVTASDELWAVGPPG
YLLQRLTKTFSHSHGTQKSSQAAMPHPEDLEDEWE
VI
Storage
-20C
Provider Type Product Number
- No reagents -