HPA001256

SRPX antibody from Sigma-Aldrich
ETX1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001256
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001256, RRID:AB_1857485
Product name
Anti-SRPX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001256
Antibody type
Polyclonal
Antigen
Sushi repeat-containing protein SRPX precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VDMEPPRIKCPSVKERIAEPNKLTVRVSWETPEGR
DTADGILTDVILKGLPPGSNFPEGDHKIQYTVYDR
AENKGTCKFRVKV
Storage
-20C
Provider Type Product Number
- No reagents -