HPA018520

CCT8 antibody from Sigma-Aldrich
C21orf112, Cctq, PRED71
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018520
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018520, RRID:AB_1846204
Product name
Anti-CCT8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018520
Antibody type
Polyclonal
Antigen
T-complex protein 1 subunit theta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEV
FLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGI
SSSSVLHGMVFKKETEGDVT
Storage
-20C
Provider Type Product Number
- No reagents -