HPA021051

CCT8 antibody from MilliporeSigma / Merck KGaA
C21orf112, Cctq, PRED71
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021051
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021051, RRID:AB_1846205
Product name
Anti-CCT8 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021051
Antibody type
Polyclonal
Antigen
T-complex protein 1 subunit theta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVLTRDKRLVPGGGATEIELAKQITSYGETCPGLE
QYAIKKFAEAFEAIPRALAENSGVKANEVISKLYA
VHQEGNKNVGLDIEAEVPAVKDMLEAGILDTYLGK
YWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGK
KDWDD
Storage
-20C
Provider Type Product Number
- No reagents -