HPA018520

CCT8 antibody from Atlas Antibodies
C21orf112, Cctq, PRED71
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018520
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018520, RRID:AB_1233710
Product name
Anti-CCT8
Provider product page
Atlas Antibodies - HPA018520
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEV
FLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGI
SSSSVLHGMVFKKETEGDVT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -