HPA018520

CCT8 antibody from Atlas Antibodies
C21orf112, Cctq, PRED71
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018520
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018520, RRID:AB_1846204
Product name
Anti-CCT8
Provider product page
Atlas Antibodies - HPA018520
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEV
FLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGI
SSSSVLHGMVFKKETEGDVT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -