ABIN309776
antibody from antibodies-online
Targeting: SCN5A
CDCD2, CMD1E, CMPD2, HB1, HB2, HBBD, HH1, ICCD, IVF, LQT3, Nav1.5, PFHB1, SSS1
Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309776 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Sodium Channel, Voltage-Gated, Type V, alpha Subunit (SCN5A) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the C terminal of human SCN5A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Zebrafish
- Host
- Rabbit
- Antigen sequence
FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEP
ITTTL RRKHEEVSAM- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Similar arrhythmicity in hypertrophic and fibrotic cardiac cultures caused by distinct substrate-specific mechanisms.
Optical mapping of cryoinjured rat myocardium grafted with mesenchymal stem cells.
Voltage-gated Na+ channel SCN5A is a key regulator of a gene transcriptional network that controls colon cancer invasion.
The histone deacetylase inhibitor suberoylanilide hydroxamic acid reduces cardiac arrhythmias in dystrophic mice.
Calcium-dependent regulation of the voltage-gated sodium channel hH1: intrinsic and extrinsic sensors use a common molecular switch.
Askar SF, Bingen BO, Schalij MJ, Swildens J, Atsma DE, Schutte CI, de Vries AA, Zeppenfeld K, Ypey DL, Pijnappels DA
Cardiovascular research 2013 Jan 1;97(1):171-81
Cardiovascular research 2013 Jan 1;97(1):171-81
Optical mapping of cryoinjured rat myocardium grafted with mesenchymal stem cells.
Costa AR, Panda NC, Yong S, Mayorga ME, Pawlowski GP, Fan K, Penn MS, Laurita KR
American journal of physiology. Heart and circulatory physiology 2012 Jan 1;302(1):H270-7
American journal of physiology. Heart and circulatory physiology 2012 Jan 1;302(1):H270-7
Voltage-gated Na+ channel SCN5A is a key regulator of a gene transcriptional network that controls colon cancer invasion.
House CD, Vaske CJ, Schwartz AM, Obias V, Frank B, Luu T, Sarvazyan N, Irby R, Strausberg RL, Hales TG, Stuart JM, Lee NH
Cancer research 2010 Sep 1;70(17):6957-67
Cancer research 2010 Sep 1;70(17):6957-67
The histone deacetylase inhibitor suberoylanilide hydroxamic acid reduces cardiac arrhythmias in dystrophic mice.
Colussi C, Berni R, Rosati J, Straino S, Vitale S, Spallotta F, Baruffi S, Bocchi L, Delucchi F, Rossi S, Savi M, Rotili D, Quaini F, Macchi E, Stilli D, Musso E, Mai A, Gaetano C, Capogrossi MC
Cardiovascular research 2010 Jul 1;87(1):73-82
Cardiovascular research 2010 Jul 1;87(1):73-82
Calcium-dependent regulation of the voltage-gated sodium channel hH1: intrinsic and extrinsic sensors use a common molecular switch.
Shah VN, Wingo TL, Weiss KL, Williams CK, Balser JR, Chazin WJ
Proceedings of the National Academy of Sciences of the United States of America 2006 Mar 7;103(10):3592-7
Proceedings of the National Academy of Sciences of the United States of America 2006 Mar 7;103(10):3592-7
No comments: Submit comment
No validations: Submit validation data