Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1544511 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Oligosaccharyltransferase 4 Homolog (S. Cerevisiae) (OST4) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for Anti-OST4 antibody is: synthetic peptide directed towards the C-terminal region of Human OST4
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKK
QE- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- For longer periods of storage, store at -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data