HPA029291

ZNF557 antibody from MilliporeSigma / Merck KGaA
MGC4054
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029291
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029291, RRID:AB_10602357
Product name
Anti-ZNF557 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029291
Antibody type
Polyclonal
Antigen
zinc finger protein 557 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GELVNELLKSWLKGLVTFEDVAVEFTQEEWALLDP
AQRTLYRDVMLENCRNLASLGNQVDKPRLISQLEQ
EDKVMTEERGILSGTCPDVENPFKAKGLTPKLHVF
RKEQSRNMKMERNHLGAT
Storage
-20C
Provider Type Product Number
- No reagents -