Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026508-M12 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026508-M12, RRID:AB_875627
- Product name
- HEYL monoclonal antibody (M12), clone 3D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant HEYL.
- Antigen sequence
MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLST
PSSSQMQARKKRRGIIEKRRRDRINSSLSELRRLV- Isotype
- IgG
- Antibody clone number
- 3D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HEYL monoclonal antibody (M12), clone 3D3 Western Blot analysis of HEYL expression in SW-13 ( Cat # L005V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HEYL monoclonal antibody (M12), clone 3D3. Western Blot analysis of HEYL expression in human pancreas.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HEYL monoclonal antibody (M12), clone 3D3. Western Blot analysis of HEYL expression in A-431.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HEYL monoclonal antibody (M12), clone 3D3. Western Blot analysis of HEYL expression in U-2 OS.