H00026508-M22

HEYL antibody from Abnova Corporation
bHLHb33, HESR3, HEY3

Antibody data

Product number
H00026508-M22
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026508-M22, RRID:AB_1204458
Product name
HEYL monoclonal antibody (M22), clone 2E12
Provider product page
Abnova Corporation - H00026508-M22
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HEYL.
Antigen sequence
MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLST
PSSSQMQARKKRRGIIEKRRRDRINSSLSELRRLV
Isotype
IgG
Antibody clone number
2E12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -