Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182428 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Hairy/enhancer-of-Split Related with YRPW Motif-Like (HEYL) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HEYL antibody: synthetic peptide directed towards the N terminal of human HEYL
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLST
PSSSQ MQARKKRRGI- Vial size
- 0.1 mg
Submitted references Sonic Hedgehog induces Notch target gene expression in vascular smooth muscle cells via VEGF-A.
Members of the HRT family of basic helix-loop-helix proteins act as transcriptional repressors downstream of Notch signaling.
Morrow D, Cullen JP, Liu W, Guha S, Sweeney C, Birney YA, Collins N, Walls D, Redmond EM, Cahill PA
Arteriosclerosis, thrombosis, and vascular biology 2009 Jul;29(7):1112-8
Arteriosclerosis, thrombosis, and vascular biology 2009 Jul;29(7):1112-8
Members of the HRT family of basic helix-loop-helix proteins act as transcriptional repressors downstream of Notch signaling.
Nakagawa O, McFadden DG, Nakagawa M, Yanagisawa H, Hu T, Srivastava D, Olson EN
Proceedings of the National Academy of Sciences of the United States of America 2000 Dec 5;97(25):13655-60
Proceedings of the National Academy of Sciences of the United States of America 2000 Dec 5;97(25):13655-60
No comments: Submit comment
No validations: Submit validation data