HPA001623

EFNB3 antibody from Sigma-Aldrich
EPLG8, LERK-8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001623
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001623, RRID:AB_1848026
Product name
Anti-EFNB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001623
Antibody type
Polyclonal
Antigen
Ephrin-B3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCD
RPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIAT
SDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGA
VPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSN
ATS
Storage
-20C
Provider Type Product Number
- No reagents -