HPA014846

GJB6 antibody from Sigma-Aldrich
CX30, DFNA3, ED2, EDH, HED
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014846
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014846, RRID:AB_1847135
Product name
Anti-GJB6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014846
Antibody type
Polyclonal
Antigen
Gap junction beta-6 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQ
NAITGFPS
Storage
-20C
Provider Type Product Number
- No reagents -