Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014846 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-GJB6
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQ
NAITGFPS- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Gap junction-mediated contraction of myoepithelial cells induces the peristaltic transport of sweat in human eccrine glands
Engraftment of Human Pluripotent Stem Cell-derived Progenitors in the Inner Ear of Prenatal Mice
Distinct Expression Patterns Of Causative Genes Responsible For Hereditary Progressive Hearing Loss In Non-Human Primate Cochlea
Long-Distance Communication between Laryngeal Carcinoma Cells
Correlations of Differentially Expressed Gap Junction Connexins Cx26, Cx30, Cx32, Cx43 and Cx46 with Breast Cancer Progression and Prognosis
Nakashima K, Kato H, Kurata R, Qianwen L, Hayakawa T, Okada F, Fujita F, Nakagawa Y, Tanemura A, Murota H, Katayama I, Sekiguchi K
Communications Biology 2023;6(1)
Communications Biology 2023;6(1)
Engraftment of Human Pluripotent Stem Cell-derived Progenitors in the Inner Ear of Prenatal Mice
Takeda H, Hosoya M, Fujioka M, Saegusa C, Saeki T, Miwa T, Okano H, Minoda R
Scientific Reports 2018;8(1)
Scientific Reports 2018;8(1)
Distinct Expression Patterns Of Causative Genes Responsible For Hereditary Progressive Hearing Loss In Non-Human Primate Cochlea
Hosoya M, Fujioka M, Ogawa K, Okano H
Scientific Reports 2016;6(1)
Scientific Reports 2016;6(1)
Long-Distance Communication between Laryngeal Carcinoma Cells
Scemes E, Antanavičiūtė I, Rysevaitė K, Liutkevičius V, Marandykina A, Rimkutė L, Sveikatienė R, Uloza V, Skeberdis V
PLoS ONE 2014;9(6):e99196
PLoS ONE 2014;9(6):e99196
Correlations of Differentially Expressed Gap Junction Connexins Cx26, Cx30, Cx32, Cx43 and Cx46 with Breast Cancer Progression and Prognosis
Scemes E, Teleki I, Szasz A, Maros M, Gyorffy B, Kulka J, Meggyeshazi N, Kiszner G, Balla P, Samu A, Krenacs T
PLoS ONE 2014;9(11):e112541
PLoS ONE 2014;9(11):e112541
No comments: Submit comment
No validations: Submit validation data