HPA020554

LRRC72 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020554
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020554, RRID:AB_1859508
Product name
Anti-AC005014.4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020554
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein ENSP00000371558 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SIAFGGKVDASWDPKSPFKQKPAQRVPSDFAFANN
VDKTVLDDPEDAVFVRSMKRSVMTLTSMNWDTVPT
REERYLEEEGTETAQMLTVT
Storage
-20C
Provider Type Product Number
- No reagents -