HPA047220

CCDC144A antibody from Atlas Antibodies
FLJ43983, KIAA0565

Antibody data

Product number
HPA047220
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA047220, RRID:AB_2679989
Product name
Anti-CCDC144A
Provider product page
Atlas Antibodies - HPA047220
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ACPEEEPLLDNSTRGTDVKDIPFNLTNNIPGCEEE
DASEISVSVVFETFPEQKEPSLKNIIHPYYHPYSG
SQEHVCQSSSK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.