PAB21518

CCDC144A antibody from Abnova Corporation
FLJ43983, KIAA0565
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
PAB21518
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21518, RRID:AB_10963200
Product name
CCDC144A polyclonal antibody
Provider product page
Abnova Corporation - PAB21518
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human CCDC144A.
Description
Rabbit polyclonal antibody raised against recombinant CCDC144A.
Reactivity
Human
Host
Rabbit
Antigen sequence
KQQPTSEATSRCHINLDETQDSKKKLGQIRSEIDL
TEAQETVPSRCLHLDAENEVLQLQQTLFSMKAIQK
QCETLQKNKKQLKQEVVNL
Isotype
IgG
Vial size
100 μL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.