HPA022996

CCDC144A antibody from MilliporeSigma / Merck KGaA
FLJ43983, KIAA0565
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022996
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA022996, RRID:AB_1846136
Product name
Anti-CCDC144A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA022996
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 144A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MESYRCRLAAAVRDCDQSQTARDLKLDFQRTRQEW
VRLHDKMKVDMSGLQAKNEILSEKLSNAESKINSL
QIQLHNTRDALGRESLILERVQRDLSQ
Storage
-20C
Provider Type Product Number
- No reagents -