HPA023009

CCDC144A antibody from Sigma-Aldrich
FLJ43983, KIAA0565
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023009
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023009, RRID:AB_1846137
Product name
Anti-CCDC144A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023009
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 144A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KQQPTSEATSRCHINLDETQDSKKKLGQIRSEIDL
TEAQETVPSRCLHLDAENEVLQLQQTLFSMKAIQK
QCETLQKNKKQLKQEVVNL
Storage
-20C
Provider Type Product Number
- No reagents -