HPA021248

PTAR1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021248
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021248, RRID:AB_1855872
Product name
Anti-PTAR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021248
Antibody type
Polyclonal
Antigen
Protein prenyltransferase alpha subunit repeat-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PADSPGGTLSDLHLIPAGSQLSQAMEVDGLNDSSK
QGYSQETKRLKRTPVPDSLGLEMEHRFIDQVLSTC
RNVEQARFASAYRKWLVTLSQ
Storage
-20C
Provider Type Product Number
- No reagents -