HPA022781

PTAR1 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022781
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA022781, RRID:AB_2171284
Product name
Anti-PTAR1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA022781
Antibody type
Polyclonal
Antigen
Protein prenyltransferase alpha subunit repeat-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VIDSSVMEQNPLRSEPALVPPKDEEAAVSTEEPRI
NLPHLLEEEVEFSTDLIDSYPGHETLWCHRRHIFY
LQHHLNGRFPHSMTQL
Storage
-20C
Provider Type Product Number
- No reagents -