HPA001252

FOXO1 antibody from Atlas Antibodies
FKH1, FKHR, FOXO1A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001252
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001252, RRID:AB_1078906
Product name
Anti-FOXO1
Provider product page
Atlas Antibodies - HPA001252
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGP
NSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVN
GRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPM
QMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGM
FIERLDCDM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -