HPA001252

FOXO1 antibody from Sigma-Aldrich
FKH1, FKHR, FOXO1A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001252
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001252, RRID:AB_1078906
Product name
Anti-FOXO1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001252
Antibody type
Polyclonal
Antigen
Forkhead box protein O1A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGP
NSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVN
GRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPM
QMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGM
FIERLDCDM
Storage
-20C
Provider Type Product Number
- No reagents -