Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R32087 - Provider product page
- Provider
- NSJ Bioreagents
- Product name
- GRP75 Antibody
- Antibody type
- Polyclonal
- Antigen
- Amino acids KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ of human HSPA9/GRP75 were used as the immunogen for the GRP75 antibody.
- Description
- Antigen affinity
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the GRP75 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of 1) rat liver, 2) rat thymus, 3) rat testis, 4) mouse liver, 5) mouse thymus, 6) mouse testis, and human 7) HeLa, 8) MCF7, 9) SW620 and 10) SMMC lysate with GRP75 antibody. Predicted/observed molecular weight ~75 kDa.
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC testing of FFPE human intestinal cancer with GRP75 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC testing of FFPE mouse kidney with GRP75 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC testing of FFPE rat kidney with GRP75 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
