Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486786 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9
- Reactivity
- Human, Mouse, Rat, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
GENIRQAASSLQQASLKLFEMAYKKMASEREGSGS
SGTGE QKEDQKEEKQ- Vial size
- 50 µg
Submitted references [Cloning and sequence analysis of the Meq gene of 4 Marek's disease virus isolates from China].
Mortalin: a protein associated with progression of Parkinson disease?
Shi WS, Liu CJ, Zhang YP, Qin YA, Zhang XW, Li JM, Chen HY
Bing du xue bao = Chinese journal of virology / [bian ji, Bing du xue bao bian ji wei yuan hui] 2008 Jun;24(2):117-25
Bing du xue bao = Chinese journal of virology / [bian ji, Bing du xue bao bian ji wei yuan hui] 2008 Jun;24(2):117-25
Mortalin: a protein associated with progression of Parkinson disease?
Shi M, Jin J, Wang Y, Beyer RP, Kitsou E, Albin RL, Gearing M, Pan C, Zhang J
Journal of neuropathology and experimental neurology 2008 Feb;67(2):117-24
Journal of neuropathology and experimental neurology 2008 Feb;67(2):117-24
No comments: Submit comment
No validations: Submit validation data