HPA000898

HSPA9 antibody from Sigma-Aldrich
GRP75, HSPA9B, mot-2, mthsp75, PBP74
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000898
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000898, RRID:AB_1079032
Product name
Anti-HSPA9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000898
Antibody type
Polyclonal
Antigen
Stress-70 protein, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMV
KNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKME
EFKDQLPADECNKLKEEISKMRELLARKDSETGEN
IRQAASSLQQASLKLFEMAYKKMASEREGSGSSGT
Storage
-20C
Provider Type Product Number
- No reagents -