HPA005534

GLI3 antibody from Sigma-Aldrich
ACLS, GCPS, PAP-A, PAPA, PAPA1, PAPB, PHS, PPDIV
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005534
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005534, RRID:AB_1078973
Product name
Anti-GLI3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005534
Antibody type
Polyclonal
Antigen
Zinc finger protein GLI3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GQQMLGQISATSHINIYQGPESCLPGAHGMGSQPS
SLAVVRGYQPCASFGGSRRQAMPRDSLALQSGQLS
DTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYD
QTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELL
SPGA
Storage
-20C
Provider Type Product Number
- No reagents -