H00023510-B01P

KCTD2 antibody from Abnova Corporation
KIAA0176
No application information provided.

Antibody data

Product number
H00023510-B01P
Provider
Abnova Corporation
Product name
KCTD2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00023510-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human KCTD2 protein.
Antigen sequence
MAELQLDPAMAGLGGGGGSGVGDGGGPVRGPPSPR
PAGPTPRGHGRPAAAVAQPLEPGPGPPERAGGGGA
ARWVRLNVGGTYFVTTRQTLGREPKSFLCRLCCQE
DPELDSDKDETGAYLIDRDPTYFGPILNYLRHGKL
IITKELAEEGVLEEAEFYNIASLVRLVKERIRDNE
NRTSQGPVKHVYRVLQCQEEELTQMVSTMSDGWKF
EQLISIGSSYNYGNEDQAEFLCVVSRELNNSTNGI
VIEPSEKAKILQERGSRM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.