Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501873 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Egl Nine Homolog 2 (C. Elegans) (EGLN2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-EGLN2 antibody: synthetic peptide directed towards the middle region of human EGLN2
- Description
- Affinity Purified
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
AVLDGSELSYFGQEGMTEVQCGKVAFQFQCSSDST
NGTGV QGGQIPELIF- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Reactivating HIF prolyl hydroxylases under hypoxia results in metabolic catastrophe and cell death.
Multiple factors affecting cellular redox status and energy metabolism modulate hypoxia-inducible factor prolyl hydroxylase activity in vivo and in vitro.
Tennant DA, Frezza C, MacKenzie ED, Nguyen QD, Zheng L, Selak MA, Roberts DL, Dive C, Watson DG, Aboagye EO, Gottlieb E
Oncogene 2009 Nov 12;28(45):4009-21
Oncogene 2009 Nov 12;28(45):4009-21
Multiple factors affecting cellular redox status and energy metabolism modulate hypoxia-inducible factor prolyl hydroxylase activity in vivo and in vitro.
Pan Y, Mansfield KD, Bertozzi CC, Rudenko V, Chan DA, Giaccia AJ, Simon MC
Molecular and cellular biology 2007 Feb;27(3):912-25
Molecular and cellular biology 2007 Feb;27(3):912-25
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
