HPA001624

RAB4B-EGLN2 antibody from Sigma-Aldrich
RERT-lncRNA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001624
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001624, RRID:AB_1079603
Product name
Anti-EGLN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001624
Antibody type
Polyclonal
Antigen
Egl nine homolog 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVA
CYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDV
KVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRR
NPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLA
SGQKGVQV
Storage
-20C
Provider Type Product Number
- No reagents -