HPA000453

KRT17 antibody from Sigma-Aldrich
PCHC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000453
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000453, RRID:AB_1079176
Product name
Anti-KRT17 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000453
Antibody type
Polyclonal
Antigen
Keratin, type I cytoskeletal 17 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TMQALEIELQSQLSMKASLEGNLAETENRYCVQLS
QIQGLIGSVEEQLAQLRCEMEQQNQEYKILLDVKT
RLEQEIATYRRLLEGEDAHLTQYKKEPVTTRQVRT
IVEEVQDGKVISSREQVHQT
Storage
-20C
Provider Type Product Number
- No reagents -