Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Chromatin Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310392 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Histone Deacetylase 9 (HDAC9) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HDAC9 antibody: synthetic peptide directed towards the C terminal of human HDAC9
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQV
IGKDL APGFVIKVII- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Detrimental effect of class-selective histone deacetylase inhibitors during tissue regeneration following hindlimb ischemia.
HDAC5 and HDAC9 in medulloblastoma: novel markers for risk stratification and role in tumor cell growth.
Chromatin regulation by Brg1 underlies heart muscle development and disease.
Mechanism of recruitment of class II histone deacetylases by myocyte enhancer factor-2.
Spallotta F, Tardivo S, Nanni S, Rosati JD, Straino S, Mai A, Vecellio M, Valente S, Capogrossi MC, Farsetti A, Martone J, Bozzoni I, Pontecorvi A, Gaetano C, Colussi C
The Journal of biological chemistry 2013 Aug 9;288(32):22915-29
The Journal of biological chemistry 2013 Aug 9;288(32):22915-29
HDAC5 and HDAC9 in medulloblastoma: novel markers for risk stratification and role in tumor cell growth.
Milde T, Oehme I, Korshunov A, Kopp-Schneider A, Remke M, Northcott P, Deubzer HE, Lodrini M, Taylor MD, von Deimling A, Pfister S, Witt O
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 Jun 15;16(12):3240-52
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 Jun 15;16(12):3240-52
Chromatin regulation by Brg1 underlies heart muscle development and disease.
Hang CT, Yang J, Han P, Cheng HL, Shang C, Ashley E, Zhou B, Chang CP
Nature 2010 Jul 1;466(7302):62-7
Nature 2010 Jul 1;466(7302):62-7
Mechanism of recruitment of class II histone deacetylases by myocyte enhancer factor-2.
Han A, He J, Wu Y, Liu JO, Chen L
Journal of molecular biology 2005 Jan 7;345(1):91-102
Journal of molecular biology 2005 Jan 7;345(1):91-102
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- ChIP