Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA054452 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA054452, RRID:AB_2682492
- Product name
- Anti-ICE1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ALSPELGASNFNDQKSSGIEYTKVVKGLTKIHSLP
RSVFMKATKDGQCESQDPRIELTLNKPDFTSLIGS
QAALIKSGLGFVKSTSWHHSDLLRKGG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The 3′ Pol II pausing at replication-dependent histone genes is regulated by Mediator through Cajal bodies’ association with histone locus bodies
The role of Mediator and Little Elongation Complex in transcription termination
Suzuki H, Abe R, Shimada M, Hirose T, Hirose H, Noguchi K, Ike Y, Yasui N, Furugori K, Yamaguchi Y, Toyoda A, Suzuki Y, Yamamoto T, Saitoh N, Sato S, Tomomori-Sato C, Conaway R, Conaway J, Takahashi H
Nature Communications 2022;13(1)
Nature Communications 2022;13(1)
The role of Mediator and Little Elongation Complex in transcription termination
Takahashi H, Ranjan A, Chen S, Suzuki H, Shibata M, Hirose T, Hirose H, Sasaki K, Abe R, Chen K, He Y, Zhang Y, Takigawa I, Tsukiyama T, Watanabe M, Fujii S, Iida M, Yamamoto J, Yamaguchi Y, Suzuki Y, Matsumoto M, Nakayama K, Washburn M, Saraf A, Florens L, Sato S, Tomomori-Sato C, Conaway R, Conaway J, Hatakeyama S
Nature Communications 2020;11(1)
Nature Communications 2020;11(1)
No comments: Submit comment
No validations: Submit validation data