HPA016604

TCL1A antibody from Sigma-Aldrich
TCL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016604
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016604, RRID:AB_1857859
Product name
Anti-TCL1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016604
Antibody type
Polyclonal
Antigen
T-cell leukemia/lymphoma protein 1A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLP
LTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSL
LPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDM
LLE
Storage
-20C
Provider Type Product Number
- No reagents -