HPA014307

S1PR2 antibody from Sigma-Aldrich
AGR16, EDG5, Gpcr13, H218
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014307
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014307, RRID:AB_1847989
Product name
Anti-S1PR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014307
Antibody type
Polyclonal
Antigen
Sphingosine 1-phosphate receptor Edg-5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSLYSEYLNPNKVQEHYNYTKETLETQETTSRQ
Storage
-20C
Provider Type Product Number
- No reagents -